FOXO4-DRI
Peptides -40%

FOXO4-DRI

Substance:

Fabricator:
Unit: 1 x
Strength:

If your order hasnt arrived within 35 days after shipping, we will resend it for free.


Out of stock

Dragon Pharma FOXO4-DRI (Proxofim) — Senolytic Peptide Research Compound

Every cell in the body is programmed to die when it becomes too damaged to function properly. In healthy tissue, this quality-control process — apoptosis — runs continuously, clearing dysfunctional cells and making room for functional replacements. Senescent cells have broken this system. They accumulate DNA damage, stop dividing, and then refuse to die — earning the label "zombie cells" in the popular science literature for good reason. They remain metabolically active, secreting a chronic inflammatory signal known as SASP that progressively degrades surrounding healthy tissue, recruits immune cells, and induces neighboring cells into senescence themselves.

FOXO4-DRI (Proxofim) was designed to restore the broken apoptosis signal in these cells. Developed at Erasmus University Medical Center and first published in Cell in 2017, it targets a specific molecular mechanism that senescent cells use to suppress p53 — their primary death signal — by keeping it bound to an elevated FOXO4 protein. By disrupting this FOXO4-p53 interaction, Dragon Pharma FOXO4-DRI releases p53 to do its intended job: initiating programmed cell death in cells that should have died already.

Dragon Pharma FOXO4-DRI is supplied as a lyophilized research-grade peptide at ≥99% HPLC purity, with LC-MS sequence and D-amino acid configuration confirmed. Every vial ships with an independent third-party Certificate of Analysis. For research use only.

Product Specifications

Parameter Detail
Brand Dragon Pharma
Compound FOXO4-DRI (Proxofim / FOXO4-D-Retro-Inverso)
Other Names AFX, AFX1, MLLT7, FOXO4a, EX-A7431, Forkhead box protein O4
Sequence LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG
(46 residues, all D-amino acids)
Chirality D-retro-inverso — reversed sequence, D-amino acid configuration
Molecular Formula C228H388N86O64
Molecular Weight 5358.05 g/mol
CAS Number 2460055-10-9
Mechanism FOXO4-p53 PPI disruption → p53 nuclear exclusion → mitochondrial apoptosis in senescent cells
Research Class Senolytic peptide — cellular senescence biology
Cell Permeability Cell-penetrating; nuclear access documented
Form Lyophilized powder
Purity ≥99% (HPLC verified)
Identity LC-MS (sequence, mass, D-chirality confirmed)
COA Independent third-party, per batch
Storage (dry) -20°C, protect from light; 24+ months
Storage (reconstituted) 2–8°C, 28 days
Original Study Baar et al., Cell, 2017 — Erasmus University Medical Center
Research Use In vitro research only

The Science in Three Layers

Layer 1 — Why Senescent Cells Are a Research Target

Cellular senescence was first described as a simple stress response — cells stop dividing to prevent damaged DNA from being replicated and passed to daughter cells. The problem is what comes next. Rather than dying cleanly, senescent cells remain metabolically active and adopt the SASP (senescence-associated secretory phenotype): a chronic, high-volume secretion of inflammatory molecules that includes IL-1α, IL-1β, IL-6, IL-8, TNF-α, CXCL1, CCL2, MMP-1, MMP-3, MMP-10, VEGF, and HGF. This output progressively degrades surrounding extracellular matrix, amplifies inflammation, induces senescence in neighboring healthy cells, and creates a tissue environment that impairs regenerative capacity. The accumulation of senescent cells with age — and the SASP burden they create — is now recognized as a significant driver of tissue dysfunction across multiple organ systems.

Layer 2 — Why Senescent Cells Resist Apoptosis

The key molecular event: in senescent cells, FOXO4 expression is elevated. FOXO4 binds p53 in the nucleus, sequestering it from its pro-apoptotic targets. Normally, when p53 is activated by DNA damage or cellular stress, it initiates transcription of pro-apoptotic genes and triggers the intrinsic apoptotic cascade. Bound to FOXO4, it cannot. The senescent cell has essentially disabled its own death switch by exploiting a physiological FOXO4 function and turning it into a survival mechanism. This is a dependency unique to senescent cells — healthy proliferating cells do not require sustained FOXO4-p53 binding to survive.

Layer 3 — How FOXO4-DRI Works

FOXO4-DRI competitively binds FOXO4 at the p53-interaction domain, preventing FOXO4 from sequestering p53. Released from nuclear retention, p53 translocates to the mitochondria — a well-characterized step in the intrinsic apoptotic pathway. At the mitochondria, p53 engages BCL-2 family pro-apoptotic proteins, triggering mitochondrial outer membrane permeabilization, cytochrome c release, caspase activation, and programmed cell death. The senescent cell is eliminated. Because healthy proliferating cells do not depend on the FOXO4-p53 survival mechanism, FOXO4-DRI does not trigger equivalent apoptosis in non-senescent populations — this selectivity is the central research rationale for its value as a senolytic tool.

Critically, research suggests FOXO4-DRI's targeted disruption spares FOXO4's antioxidant transcriptional function — FOXO4 retains its role as activator of MnSOD, catalase, and GPX antioxidant enzyme genes. The peptide inhibits one specific interaction, not FOXO4 function globally.

Published Research Timeline

Year Publication Key Finding
2017 Cell — Baar et al. Foundational study: FOXO4-DRI reduces senescent cell burden in aged mice, improves kidney function, exercise tolerance, fur density, and physical activity markers
2018 FEBS Letters — Bourgeois & Madl Molecular characterization of the FOXO4-p53 axis regulation in cellular senescence
2019 Zhao et al. (NSCLC radiosensitivity) FOXO4-DRI enhances radiosensitivity of non-small cell lung cancer by clearing senescent cancer-associated fibroblasts
2020 Aging (Albany NY) — Zhang et al. FOXO4-DRI targets senescent Leydig cells, improving testicular microenvironment and testosterone levels in aged mice
2021 Front. Bioeng. Biotechnol. — Huang et al. Senolytic removal of senescent cells from in vitro expanded human chondrocytes relevant to autologous chondrocyte implantation research
2022 J. Cell. Mol. Med. — Han et al. FOXO4-DRI targets myofibroblasts in bleomycin-induced pulmonary fibrosis, reducing SASP and collagen deposition
2025 Communications Biology — Kong et al. FOXO4-DRI induces apoptosis in keloid senescent fibroblasts via p53-serine 15 phosphorylation nuclear exclusion — extends to wound healing / aberrant scarring research
2025 Nature Communications — Bourgeois et al. Most detailed molecular characterization of FOXO4-DRI / p53 interaction mechanism to date
2026 Front. Bioeng. Biotechnol. — Hu et al. FOXO4-DRI regulates endothelial cell senescence via p53 signaling — first published data in vascular aging biology context

Key Features

  • The most extensively published peptide-based senolytic tool compound — nine peer-reviewed publications from 2017 to 2026 across Cell, Nature Communications, Communications Biology, FEBS Letters, Frontiers, and Aging (Albany NY)
  • D-retro-inverso architecture — proteolysis-resistant — D-amino acids and reversed sequence protect against enzymatic degradation; substantially extended functional viability versus L-peptide equivalents in biological research environments
  • FOXO4-p53 PPI selectivity — exploits a senescent cell-specific survival dependency; proposed sparing of healthy proliferating cells distinguishes it from broad cytotoxic approaches
  • 2025 and 2026 research updates included — keloid fibroblast (2025) and endothelial cell vascular aging (2026) publications extend the research profile beyond the original 2017 aging models; both absent from most competitor product pages
  • Cell-penetrating nuclear access — documented penetration of cellular and nuclear membranes enabling intranuclear FOXO4-p53 complex interaction
  • Antioxidant function preservation proposed — selective FOXO4-p53 disruption without impairing FOXO4's MnSOD/catalase/GPX antioxidant transcriptional role
  • ≥99% HPLC purity with LC-MS D-chirality verification — complete identity confirmation for a 46-residue D-amino acid compound; chirality verification is a critical quality step HPLC alone cannot provide
  • Independent third-party COA per batch — lot-traceable documentation; not in-house or reused across production runs

Research Benefits

The only characterized peptide-based senolytic with a Cell-published proof-of-concept study. Most senolytic research compounds available from research peptide suppliers lack peer-reviewed validation at the level FOXO4-DRI has achieved. The 2017 Baar et al. Cell paper remains the most rigorous published demonstration of peptide-mediated senolytic activity in aging animal models — providing a research foundation that narrows or eliminates the gap between purchasing a compound and being able to contextualize experimental results within established literature.

Nine publications across nine years of expanding research. A compound with a single founding paper and nothing since is a research dead-end. FOXO4-DRI has generated continuous publication activity from 2017 through January 2026, expanding from core aging models into oncology, fibrosis, reproductive endocrinology, cartilage biology, keloid scarring, and vascular aging. Each new domain opens new comparative research questions that benefit from the existing 2017 baseline.

Mechanistic precision that broad senolytics cannot offer. Dasatinib/quercetin and navitoclax inhibit anti-apoptotic proteins across cell types. FOXO4-DRI targets one specific protein-protein interaction that exists as a survival mechanism in senescent cells but not in healthy proliferating cells. For researchers studying senescence-specific biology rather than general apoptosis, this mechanistic precision is essential for designing interpretable experiments.

A quality challenge that most suppliers underestimate. For a 46-residue, all-D-amino acid peptide, HPLC purity alone does not confirm compound identity. An L-amino acid FOXO4 peptide at 99% purity would show an identical HPLC chromatogram to the correctly synthesized D-retro-inverso version — while being functionally inactive and proteolytically unstable. Dragon Pharma's LC-MS verification explicitly confirms D-chirality per batch, closing the quality gap that purity-only testing leaves open.

Why D-Chirality Verification Matters for FOXO4-DRI

At 5358.05 g/mol and 46 residues, FOXO4-DRI is the largest research peptide in the Dragon Pharma catalog. Its defining characteristic — D-amino acid configuration — is what makes it proteolysis-resistant and functionally viable in biological environments. It is also completely invisible to standard HPLC purity analysis, which cannot distinguish D-amino acid peptides from their L-amino acid equivalents by chromatographic retention time alone.

Dragon Pharma's batch testing applies LC-MS analysis that explicitly confirms:

  • Correct 46-residue sequence in retro-inverso orientation
  • 5358.05 g/mol molecular mass within specification
  • D-amino acid configuration verification through mass fragmentation analysis
  • Absence of truncated synthesis fragments or L-amino acid contamination

Combined with ≥99% HPLC purity, sterility and endotoxin testing, and independent third-party batch-specific COA documentation, this provides complete characterization for a compound where synthesis complexity genuinely demands it.

Frequently Asked Questions

Everything you need to know about Dragon Pharma FOXO4-DRI (Proxofim), its senolytic mechanism, FOXO4-p53 biology, research applications, and quality standards.

What is Dragon Pharma FOXO4-DRI and what is it used for?

Dragon Pharma FOXO4-DRI (Proxofim) is a research-grade synthetic D-retro-inverso peptide of 46 residues (CAS 2460055-10-9, MW 5358.05 g/mol) designed to disrupt the FOXO4-p53 protein-protein interaction in senescent cells, restoring p53's capacity to initiate intrinsic apoptotic signaling. It is the most extensively published peptide-based senolytic tool compound in the research market, with peer-reviewed publications spanning cellular aging, pulmonary fibrosis, cartilage biology, oncology, endocrine research, keloid scarring, and vascular aging. For research use only.

What does D-retro-inverso mean and why does it matter for research?

DRI peptides combine two structural modifications: reversed sequence direction (retro) and inverted D-amino acid stereochemistry at each residue (inverso). Together they recreate the molecular binding surface of the original peptide while rendering the compound invisible to proteolytic enzymes that recognize only natural L-amino acid substrates. Dragon Pharma FOXO4-DRI's D-architecture substantially extends its functional stability in biological research environments compared to any L-peptide equivalent, and makes it a valuable peptidomimetic for protein-protein interaction studies.

What is SASP and how does it relate to FOXO4-DRI research?

SASP (senescence-associated secretory phenotype) is the chronic inflammatory output of senescent cells — including IL-1α, IL-1β, IL-6, IL-8, TNF-α, matrix metalloproteinases, and VEGF. This output progressively degrades surrounding extracellular matrix, recruits immune cells, and induces neighboring cells into senescence. SASP is a central driver of age-related tissue deterioration and multiple chronic disease processes. FOXO4-DRI addresses SASP burden by eliminating senescent cells at source through selective apoptosis induction, rather than suppressing individual SASP components downstream.

What was documented in the landmark 2017 Cell study?

Baar et al. (2017, Erasmus University Medical Center) administered FOXO4-DRI to naturally aged mice, chemotherapy-induced senescence models, and XPF-ERCC1 fast-aging mice. Documented outcomes included reductions in p21 and γ-H2AX senescence burden markers, liver histological changes, improved kidney function markers, increased fur density in areas of alopecia, enhanced exercise tolerance, greater physical activity levels, and reduced markers of musculoskeletal and cardiac dysfunction in aged animals. This study established the research framework for peptide-based selective senolysis and remains the primary published reference anchor for FOXO4-DRI.

What 2025 and 2026 research has been published on FOXO4-DRI?

Three significant publications: a July 2025 Nature Communications study (Bourgeois et al.) provided the most detailed molecular characterization of the FOXO4-DRI/p53 interaction mechanism to date. A February 2025 Communications Biology paper (Kong et al.) demonstrated FOXO4-DRI-induced apoptosis in keloid senescent fibroblasts via p53-serine 15 phosphorylation nuclear exclusion — extending the research profile to wound healing and aberrant scarring. A January 2026 Frontiers in Bioengineering and Biotechnology publication (Hu et al.) documented FOXO4-DRI regulation of endothelial cell senescence via p53 signaling — the first published data in a vascular aging research context.

Does FOXO4-DRI affect FOXO4's antioxidant functions?

Research suggests FOXO4-DRI's targeted disruption of the FOXO4-p53 interaction does not significantly impair FOXO4's role as a transcriptional activator of antioxidant enzyme genes including manganese superoxide dismutase (MnSOD), catalase (CAT), and glutathione peroxidase (GPX). FOXO4 retains its capacity to regulate oxidative stress defense while losing its ability to sequester p53 in senescent cells. This mechanistic separation between FOXO4-p53 inhibition and antioxidant function preservation is a key research rationale for FOXO4-DRI's positioning as a selective senolytic.

Why is D-chirality verification critical for FOXO4-DRI quality?

HPLC purity analysis cannot distinguish D-amino acid peptides from their L-amino acid equivalents by chromatographic retention time. An L-amino acid version of the same sequence at 99% HPLC purity would be functionally inactive at its FOXO4 target and proteolytically unstable — but indistinguishable from the correct D-retro-inverso compound on a standard purity readout. Dragon Pharma applies LC-MS per batch to explicitly verify D-chirality through mass fragmentation analysis, closing the quality gap that purity-only testing leaves open for this compound class.

What research areas has FOXO4-DRI been studied across?

Dragon Pharma FOXO4-DRI has been investigated across eight distinct research domains in published studies: (1) age-related tissue dysfunction and healthspan in aging animal models; (2) NSCLC radiosensitivity through senescent cancer-associated fibroblast clearance; (3) bleomycin-induced pulmonary fibrosis and myofibroblast senescence; (4) age-related testosterone decline via Leydig cell senescence; (5) cartilage biology and chondrocyte ACI preparation; (6) keloid scarring and aberrant wound healing; (7) endothelial cell and vascular aging; and (8) neurodegenerative disease models through proteasomal activity research.

How does FOXO4-DRI compare to other senolytic approaches?

The most widely researched alternative senolytics — dasatinib/quercetin and navitoclax (ABT-263) — inhibit anti-apoptotic BCL-2 family proteins across cell types, producing broader apoptotic effects without exploiting a senescent-cell-specific survival dependency. FOXO4-DRI targets a mechanism — FOXO4-p53 binding — that senescent cells rely on but healthy proliferating cells do not. This mechanistic specificity makes FOXO4-DRI the preferred tool compound for research specifically investigating the selective senolytic hypothesis rather than general anti-apoptotic pathway biology.

Storage

Proper handling and preservation guidelines for FOXO4-DRI peptide.

Lyophilized powder: -20°C, protected from light and moisture. Stable 24 months or longer. No cold chain required for shipping in lyophilized form. Allow vial to equilibrate to room temperature before opening.

Reconstituted solution: Store at 2–8°C. Use within 28 days. Do not refreeze reconstituted material. Freeze-thaw cycling degrades the 46-residue peptide chain and reduces experimental reproducibility.

Reconstitution protocol: Add bacteriostatic water or sterile PBS slowly against the inner vial wall — not directly into the lyophilized cake. Swirl gently until fully dissolved. Do not shake or vortex. FOXO4-DRI is cell-penetrating; handle in appropriate containment for research compounds with nuclear access. Maintain sterile technique throughout.

For research use only. Not for human consumption, veterinary use, or therapeutic application.

No reviews found

Please log in to write FOXO4-DRI review.

Related Offers
Domestic & International
TriTren 150
10 ml - 150 mg/ml
Substance: Trenbolone Acetate,Trenbolone Hexahydrobenzylcarbonate,Trenbolone Enanthate

Fabricator: Dragon Pharma, Europe
Unit: 1 x 10 ml
Strength: 150 mg/ml

If your order hasnt arrived within 35 days after shipping, we will resend it for free.


$103.00
Shipped USA Domestic
Trenbolone 50
10 ml - 50 mg/ml
Substance: Trenbolone Suspension

Fabricator: Dragon Pharma, Europe
Unit: 1 x 10 ml
Strength: 50 mg/ml

If your order hasnt arrived within 35 days after shipping, we will resend it for free.


$116.00
Domestic & International
Trenbolone 200
10 ml - 200 mg/ml
Substance: Trenbolone Enanthate

Fabricator: Dragon Pharma, Europe
Unit: 1 x 10 ml
Strength: 200 mg/ml

If your order hasnt arrived within 35 days after shipping, we will resend it for free.


$134.00
Domestic & International
Buy 3 and get 1 for FREE
Trenbolone 100
10 ml - 100 mg/ml
Substance: Trenbolone Acetate

Fabricator: Dragon Pharma, Europe
Unit: 1 x 10 ml
Strength: 100 mg/ml

If your order hasnt arrived within 35 days after shipping, we will resend it for free.


$100.00
Buy 3 and get 1 for FREE
Buy 5+ for $95.00 and save $25.00
Shipped USA Domestic
Toremfine
100 tabs - 20 mg/tab
Substance: Toremifene Citrate

Fabricator: Dragon Pharma, Europe
Unit: 1 x 100 tabs
Strength: 20 mg/tab

If your order hasnt arrived within 35 days after shipping, we will resend it for free.


$150.00
Domestic & International
Testo Blend 350
10 ml - 350 mg/ml
Substance: Testosterone Enanthate,Testosterone Cypionate,Testosterone Propionate

Fabricator: Dragon Pharma, Europe
Unit: 1 x 10 ml
Strength: 350 mg/ml

If your order hasnt arrived within 35 days after shipping, we will resend it for free.


$66.00
Domestic & International
Buy 3 and get 1 for FREE
T3
100 tabs - 25 mcg/tab
T3
Substance: Liothyronine Sodium

Fabricator: Dragon Pharma, Europe
Unit: 1 x 100 tabs
Strength: 25 mcg/tab

If your order hasnt arrived within 35 days after shipping, we will resend it for free.


$44.00
Buy 3 and get 1 for FREE
Buy 5+ for $40.92 and save $15.40
Domestic & International
Sustanon 270
10 ml - 270 mg/ml
Substance: Testosterone Acetate,Testosterone Propionate,Testosterone PhenylPropionate,Testosterone Isocaproate,Testosterone Decanoate

Fabricator: Dragon Pharma, Europe
Unit: 1 x 10 ml
Strength: 270 mg/ml

If your order hasnt arrived within 35 days after shipping, we will resend it for free.


$61.00

Add to Cart - Product(s)

Close Button
Empty

Total Cost: